>Example1 AACARFIDDFCDTLTPNIYRPRDNGQRCYAVNGHRCDFTVFNTNNGGNPIRASTPNCKTVLRTAANRCPTGGRGKINPNAPFLFAIDPNDGDCSTNF >Example2 TIWRNQHTYKMATSASANLSKIVKKNYMELPQDGKVQ |
NOTE: (2) Each peptide sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description. (3) If a query sequence contains any character other than the 20 single-letter codes for the 20 native amino acids, the prediction will be stopped with a warning message. |