O31699
UniProt ID : O31699
NCBI Taxonomy : 224308
Protein names : Thiol-disulfide oxidoreductase YkuV
Organism : Bacillus subtilis (strain 168)
Taxonomy : Bacteria
Subcellular locations :Cytoplasm;
Length : 148
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0009055Molecullar Functionelectron carrier activityIEA
GO:0015035Molecullar Functionprotein disulfide oxidoreductase activityIEA
GO:0045454Biological Processcell redox homeostasisIEA
GO:0006662Biological Processglycerol ether metabolic processIEA
SWISS-MODEL Repository :O31699
Sequences : MKLRQPMPELTGEKAWLNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQLNVVAVHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLAETE
Function :Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.