| O31699 |
| UniProt ID : |
O31699 |
| NCBI Taxonomy : |
224308 |
| Protein names : |
Thiol-disulfide oxidoreductase YkuV |
| Organism : |
Bacillus subtilis (strain 168) |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Cytoplasm; |
| Length : |
148 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0009055 | Molecullar Function | electron carrier activity | IEA | | GO:0015035 | Molecullar Function | protein disulfide oxidoreductase activity | IEA | | GO:0045454 | Biological Process | cell redox homeostasis | IEA | | GO:0006662 | Biological Process | glycerol ether metabolic process | IEA | |
| SWISS-MODEL Repository : | O31699 |
| Sequences : |
MKLRQPMPELTGEKAWLNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQLNVVAVHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLAETE |
| Function : | Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. |