| O31687 |
| UniProt ID : |
O31687 |
| NCBI Taxonomy : |
224308 |
| Protein names : |
Sporulation thiol-disulfide oxidoreductase A |
| Organism : |
Bacillus subtilis (strain 168) |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Spore wall; |
| Length : |
165 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0043594 | Cellular Component | outer endospore membrane | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0016491 | Molecullar Function | oxidoreductase activity | IEA | | GO:0045454 | Biological Process | cell redox homeostasis | IEA | | GO:0030435 | Biological Process | sporulation resulting in formation of a cellular spore | IEA | |
| SWISS-MODEL Repository : | O31687 |
| Sequences : |
MLTKRLLTIYIMLLGLIAWFPGAAQAEEKQPAVPAVFLMKTIEGEDISIPNKGQKTILHFWTSWCPPCKKELPQFQSFYDAHPSDSVKLVTVNLVNSEQNQQVVEDFIKANKLTFPIVLDSKGELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLKEWTEE |
| Function : | Thiol-disulfide oxidoreductase with a reductive function, involved in spore cortex synthesis. It could be involved either in breaking disulfide bonds in cortex components or in proteins that are important for cortex synthesis, or in thiol/disulfide bond interchange. |