O31687
UniProt ID : O31687
NCBI Taxonomy : 224308
Protein names : Sporulation thiol-disulfide oxidoreductase A
Organism : Bacillus subtilis (strain 168)
Taxonomy : Bacteria
Subcellular locations :Spore wall;
Length : 165
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0043594Cellular Componentouter endospore membraneIEA
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0016491Molecullar Functionoxidoreductase activityIEA
GO:0045454Biological Processcell redox homeostasisIEA
GO:0030435Biological Processsporulation resulting in formation of a cellular sporeIEA
SWISS-MODEL Repository :O31687
Sequences : MLTKRLLTIYIMLLGLIAWFPGAAQAEEKQPAVPAVFLMKTIEGEDISIPNKGQKTILHFWTSWCPPCKKELPQFQSFYDAHPSDSVKLVTVNLVNSEQNQQVVEDFIKANKLTFPIVLDSKGELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLKEWTEE
Function :Thiol-disulfide oxidoreductase with a reductive function, involved in spore cortex synthesis. It could be involved either in breaking disulfide bonds in cortex components or in proteins that are important for cortex synthesis, or in thiol/disulfide bond interchange.