O14463
UniProt ID : O14463
NCBI Taxonomy : 284812
Protein names : Thioredoxin-1
Organism : Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Taxonomy : Eukaryota
Length : 103
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolIDA
GO:0005634Cellular ComponentnucleusIDA
GO:0016209Molecullar Functionantioxidant activityIDA
GO:0009055Molecullar Functionelectron carrier activityIEA
GO:0003756Molecullar Functionprotein disulfide isomerase activityIDA
GO:0015035Molecullar Functionprotein disulfide oxidoreductase activityIDA
GO:0045454Biological Processcell redox homeostasisIMP
GO:0006662Biological Processglycerol ether metabolic processIEA
GO:0042744Biological Processhydrogen peroxide catabolic processIMP
GO:1900409Biological Processpositive regulation of cellular response to oxidative stressIMP
Sequences : MVKQVSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDATFIKVDVDQLSEIAAEAGVHAMPSFFLYKNGEKIEEIVGANPAKLEASIKANL
Function :Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.