O14463 |
UniProt ID : |
O14463 |
NCBI Taxonomy : |
284812 |
Protein names : |
Thioredoxin-1 |
Organism : |
Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
Taxonomy : |
Eukaryota |
Length : |
103 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0005634 | Cellular Component | nucleus | IDA | GO:0016209 | Molecullar Function | antioxidant activity | IDA | GO:0009055 | Molecullar Function | electron carrier activity | IEA | GO:0003756 | Molecullar Function | protein disulfide isomerase activity | IDA | GO:0015035 | Molecullar Function | protein disulfide oxidoreductase activity | IDA | GO:0045454 | Biological Process | cell redox homeostasis | IMP | GO:0006662 | Biological Process | glycerol ether metabolic process | IEA | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IMP | GO:1900409 | Biological Process | positive regulation of cellular response to oxidative stress | IMP | |
Sequences : |
MVKQVSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDATFIKVDVDQLSEIAAEAGVHAMPSFFLYKNGEKIEEIVGANPAKLEASIKANL |
Function : | Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. |