| O08997 |
| UniProt ID : |
O08997 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Copper transport protein ATOX1 |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Length : |
68 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016531 | Molecullar Function | copper chaperone activity | IEA | | GO:0006878 | Biological Process | cellular copper ion homeostasis | IMP | | GO:0006825 | Biological Process | copper ion transport | IMP | | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
|
| SWISS-MODEL Repository : | O08997 |
| Sequences : |
MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK |
| Function : | Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense (By similarity). |