O08709
UniProt ID : O08709
NCBI Taxonomy : 10090
Protein names : Peroxiredoxin-6
Organism : Mus musculus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Lysosome;Cytoplasmic vesicle;
Length : 224
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0016023Cellular Componentcytoplasmic membrane-bounded vesicleIEA
GO:0005829Cellular ComponentcytosolIDA
GO:0005764Cellular ComponentlysosomeIEA
GO:0005739Cellular ComponentmitochondrionIDA
GO:0004602Molecullar Functionglutathione peroxidase activityIEA
GO:0016787Molecullar Functionhydrolase activityIEA
GO:0004601Molecullar Functionperoxidase activityIMP
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0032060Biological Processbleb assemblyIMP
GO:0016042Biological Processlipid catabolic processIEA
GO:0000302Biological Processresponse to reactive oxygen speciesIMP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.2 glutathione + H2O2 = glutathione disulfide + 2 H2O.
SWISS-MODEL Repository :O08709
Sequences : MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
Function :Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury (By similarity).