| O08709 |
| UniProt ID : |
O08709 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Peroxiredoxin-6 |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Lysosome;Cytoplasmic vesicle; |
| Length : |
224 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016023 | Cellular Component | cytoplasmic membrane-bounded vesicle | IEA | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005764 | Cellular Component | lysosome | IEA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0004602 | Molecullar Function | glutathione peroxidase activity | IEA | | GO:0016787 | Molecullar Function | hydrolase activity | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IMP | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | | GO:0032060 | Biological Process | bleb assembly | IMP | | GO:0016042 | Biological Process | lipid catabolic process | IEA | | GO:0000302 | Biological Process | response to reactive oxygen species | IMP | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.2 glutathione + H2O2 = glutathione disulfide + 2 H2O. |
| SWISS-MODEL Repository : | O08709 |
| Sequences : |
MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP |
| Function : | Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury (By similarity). |