Q9Y7F0
UniProt ID : Q9Y7F0
NCBI Taxonomy : 237561
Protein names : Peroxiredoxin TSA1
Organism : Candida albicans (strain SC5314 / ATCC MYA-2876)
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 196
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0009986Cellular Componentcell surfaceIDA
GO:0005737Cellular ComponentcytoplasmIDA
GO:0030446Cellular Componenthyphal cell wallIDA
GO:0005634Cellular ComponentnucleusIDA
GO:0030985Molecullar Functionhigh molecular weight kininogen bindingIDA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIDA
GO:0036171Biological Processfilamentous growth of a population of unicellular organisms in response to chemical stimulusIMP
GO:0036170Biological Processfilamentous growth of a population of unicellular organisms in response to starvationIMP
GO:0031505Biological Processfungal-type cell wall organizationIMP
GO:0042744Biological Processhydrogen peroxide catabolic processIGI
GO:0051701Biological Processinteraction with hostIPI
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q9Y7F0
Sequences : MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK
Function :Physiologically important antioxidant which constitutes an enzymatic defense against sulfur-containing radicals. Can provide protection against a thiol-containing oxidation system but not against an oxidation system without thiol.