| Q9Y7F0 |
| UniProt ID : |
Q9Y7F0 |
| NCBI Taxonomy : |
237561 |
| Protein names : |
Peroxiredoxin TSA1 |
| Organism : |
Candida albicans (strain SC5314 / ATCC MYA-2876) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
196 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009986 | Cellular Component | cell surface | IDA | | GO:0005737 | Cellular Component | cytoplasm | IDA | | GO:0030446 | Cellular Component | hyphal cell wall | IDA | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0030985 | Molecullar Function | high molecular weight kininogen binding | IDA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | | GO:0036171 | Biological Process | filamentous growth of a population of unicellular organisms in response to chemical stimulus | IMP | | GO:0036170 | Biological Process | filamentous growth of a population of unicellular organisms in response to starvation | IMP | | GO:0031505 | Biological Process | fungal-type cell wall organization | IMP | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IGI | | GO:0051701 | Biological Process | interaction with host | IPI | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q9Y7F0 |
| Sequences : |
MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK |
| Function : | Physiologically important antioxidant which constitutes an enzymatic defense against sulfur-containing radicals. Can provide protection against a thiol-containing oxidation system but not against an oxidation system without thiol. |