Q9Y5Z9 |
UniProt ID : |
Q9Y5Z9 |
NCBI Taxonomy : |
9606 |
Protein names : |
UbiA prenyltransferase domain-containing protein 1 |
Organism : |
Homo sapiens |
Taxonomy : |
Eukaryota |
Subcellular locations : | Endoplasmic reticulum membrane;Golgi apparatus membrane;Mitochondrion membrane;Cytoplasm;Nucleus; |
Length : |
338 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005783 | Cellular Component | endoplasmic reticulum | IDA | GO:0005789 | Cellular Component | endoplasmic reticulum membrane | IEA | GO:0030173 | Cellular Component | integral to Golgi membrane | IDA | GO:0031966 | Cellular Component | mitochondrial membrane | IEA | GO:0005634 | Cellular Component | nucleus | IDA | GO:0016209 | Molecullar Function | antioxidant activity | IMP | GO:0004659 | Molecullar Function | prenyltransferase activity | IDA | GO:0009234 | Biological Process | menaquinone biosynthetic process | IMP | GO:0006744 | Biological Process | ubiquinone biosynthetic process | IMP | GO:0042371 | Biological Process | vitamin K biosynthetic process | IDA | |
Sequences : |
MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI |
Function : | Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10. MK-4 is a vitamin K2 isoform present at high concentrations in the brain, kidney and pancreas, and is required for endothelial cell development. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosyntetic enzyme: coenzyme Q10, also named ubiquinone, plays a important antioxidant role in the cardiovascular system. Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from NOS3/eNOS-dependent oxidative stress. |