| Q9XT28 |
| UniProt ID : |
Q9XT28 |
| NCBI Taxonomy : |
9940 |
| Protein names : |
Copper transport protein ATOX1 |
| Organism : |
Ovis aries |
| Taxonomy : |
Eukaryota |
| Length : |
68 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0006825 | Biological Process | copper ion transport | IEA | |
|
| SWISS-MODEL Repository : | Q9XT28 |
| Sequences : |
MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCINSEHSVDTLLETLGKTGKAVSYLGPK |
| Function : | Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense (By similarity). |