| Q9XEX2 |
| UniProt ID : |
Q9XEX2 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
Peroxiredoxin-2B |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
162 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009507 | Cellular Component | chloroplast | IDA | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005886 | Cellular Component | plasma membrane | IDA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | | GO:0046686 | Biological Process | response to cadmium ion | IEP | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q9XEX2 |
| Sequences : |
MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKAEELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGVRSRRFALLLDDLKVTVANVESGGEFTVSSADDILKAL |
| Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling. |