Q9XEX2 |
UniProt ID : |
Q9XEX2 |
NCBI Taxonomy : |
3702 |
Protein names : |
Peroxiredoxin-2B |
Organism : |
Arabidopsis thaliana |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
162 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009507 | Cellular Component | chloroplast | IDA | GO:0005829 | Cellular Component | cytosol | IDA | GO:0005886 | Cellular Component | plasma membrane | IDA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0046686 | Biological Process | response to cadmium ion | IEP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q9XEX2 |
Sequences : |
MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKAEELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGVRSRRFALLLDDLKVTVANVESGGEFTVSSADDILKAL |
Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling. |