| Q9WUC4 |
| UniProt ID : |
Q9WUC4 |
| NCBI Taxonomy : |
10116 |
| Protein names : |
Copper transport protein ATOX1 |
| Organism : |
Rattus norvegicus |
| Taxonomy : |
Eukaryota |
| Length : |
68 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016531 | Molecullar Function | copper chaperone activity | IEA | | GO:0005507 | Molecullar Function | copper ion binding | IMP | | GO:0006878 | Biological Process | cellular copper ion homeostasis | IEA | | GO:0006825 | Biological Process | copper ion transport | IEA | | GO:0006979 | Biological Process | response to oxidative stress | IDA | |
|
| SWISS-MODEL Repository : | Q9WUC4 |
| Sequences : |
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVEFNIDLPNKKVCIESEHSSDILLATLNKTGKAVSYLGPK |
| Function : | Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense (By similarity). |