Q9VX10 |
UniProt ID : |
Q9VX10 |
NCBI Taxonomy : |
7227 |
Protein names : |
Putative sulfiredoxin |
Organism : |
Drosophila melanogaster |
Taxonomy : |
Eukaryota |
Length : |
162 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005524 | Molecullar Function | ATP binding | IEA | GO:0003677 | Molecullar Function | DNA binding | IEA | GO:0032542 | Molecullar Function | sulfiredoxin activity | IEA | |
Catalytic activity : | Peroxiredoxin-(S-hydroxy-S-oxocysteine) + ATP + 2 R-SH = peroxiredoxin-(S-hydroxycysteine) + ADP + phosphate + R-S-S-R. |
SWISS-MODEL Repository : | Q9VX10 |
Sequences : |
MEFISHFLRATSRRTAALGPILQRNRSEIIQKQSLTNRQAFRRYRSSCSTMDTTVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEVPPIDLLWISGSEGGDYYFSFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAPKYLA |
Function : | Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase (By similarity). |