Q9VX10
UniProt ID : Q9VX10
NCBI Taxonomy : 7227
Protein names : Putative sulfiredoxin
Organism : Drosophila melanogaster
Taxonomy : Eukaryota
Length : 162
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005524Molecullar FunctionATP bindingIEA
GO:0003677Molecullar FunctionDNA bindingIEA
GO:0032542Molecullar Functionsulfiredoxin activityIEA
Catalytic activity :Peroxiredoxin-(S-hydroxy-S-oxocysteine) + ATP + 2 R-SH = peroxiredoxin-(S-hydroxycysteine) + ADP + phosphate + R-S-S-R.
SWISS-MODEL Repository :Q9VX10
Sequences : MEFISHFLRATSRRTAALGPILQRNRSEIIQKQSLTNRQAFRRYRSSCSTMDTTVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEVPPIDLLWISGSEGGDYYFSFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAPKYLA
Function :Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase (By similarity).