Q9V3P0 |
UniProt ID : |
Q9V3P0 |
NCBI Taxonomy : |
7227 |
Protein names : |
Peroxiredoxin 1 |
Organism : |
Drosophila melanogaster |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
194 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0005875 | Cellular Component | microtubule associated complex | IDA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | GO:0007155 | Biological Process | cell adhesion | IMP | GO:0045454 | Biological Process | cell redox homeostasis | IDA | GO:0008340 | Biological Process | determination of adult lifespan | IMP | GO:0007281 | Biological Process | germ cell development | IMP | GO:0008354 | Biological Process | germ cell migration | IMP | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IDA | GO:0006974 | Biological Process | response to DNA damage stimulus | IMP | GO:0042594 | Biological Process | response to starvation | IMP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q9V3P0 |
Sequences : |
MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS |
Function : | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. As a reducing substrate, thioredoxin 2 is preferred over thioredoxin 1. |