Q9V3P0
UniProt ID : Q9V3P0
NCBI Taxonomy : 7227
Protein names : Peroxiredoxin 1
Organism : Drosophila melanogaster
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 194
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolIDA
GO:0005875Cellular Componentmicrotubule associated complexIDA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIDA
GO:0007155Biological Processcell adhesionIMP
GO:0045454Biological Processcell redox homeostasisIDA
GO:0008340Biological Processdetermination of adult lifespanIMP
GO:0007281Biological Processgerm cell developmentIMP
GO:0008354Biological Processgerm cell migrationIMP
GO:0042744Biological Processhydrogen peroxide catabolic processIDA
GO:0006974Biological Processresponse to DNA damage stimulusIMP
GO:0042594Biological Processresponse to starvationIMP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q9V3P0
Sequences : MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. As a reducing substrate, thioredoxin 2 is preferred over thioredoxin 1.