| Q9USR1 |
| UniProt ID : |
Q9USR1 |
| NCBI Taxonomy : |
284812 |
| Protein names : |
Thioredoxin-like protein 1 |
| Organism : |
Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Nucleus; |
| Length : |
290 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0009055 | Molecullar Function | electron carrier activity | IEA | | GO:0015035 | Molecullar Function | protein disulfide oxidoreductase activity | IEA | | GO:0045454 | Biological Process | cell redox homeostasis | IC | | GO:0071448 | Biological Process | cellular response to alkyl hydroperoxide | IMP | | GO:0006662 | Biological Process | glycerol ether metabolic process | IEA | | GO:0010498 | Biological Process | proteasomal protein catabolic process | ISM | |
| Sequences : |
MSVIEIRSYQHWISTIPKSGYLAVDCYADWCGPCKAISPLFSQLASKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVFFENGKQIDMLTGANPQALKEKVALISSKATGTGALASSSSAPVKGFASLQGCIENPQLECLNQQDDHDLKSAFNSNPSSFLESDVDEQLMIYIPFLEVVKVHSIAITPVKGETSSAPKTIKLYINQPNNLSFEDAESFTPTQVIEDIVYEQDDQPTIIPLRFVKFQRVNSLVIFIYSNVGEEETTKISRLELFGEPVGDSSKGKLQKVEA |
| Function : | Has a role in cellular detoxification of alkyl hydroperoxide. |