Q9TSX9 |
UniProt ID : |
Q9TSX9 |
NCBI Taxonomy : |
9823 |
Protein names : |
Peroxiredoxin-6 |
Organism : |
Sus scrofa |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm;Lysosome;Cytoplasmic vesicle; |
Length : |
224 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | ISS | GO:0016023 | Cellular Component | cytoplasmic membrane-bounded vesicle | IEA | GO:0005764 | Cellular Component | lysosome | IEA | GO:0004602 | Molecullar Function | glutathione peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0004623 | Molecullar Function | phospholipase A2 activity | IEA | GO:0009395 | Biological Process | phospholipid catabolic process | IEA | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.2 glutathione + H2O2 = glutathione disulfide + 2 H2O. |
SWISS-MODEL Repository : | Q9TSX9 |
Sequences : |
MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKMIALSIDSVEDHLAWSKDINAYNGEEPKETLPFPIIDDKSRDLAIQLGMLDPAEKDEQGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVIISLQLTAEKRVATPVDWKNGDSVMVLPNIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Function : | Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury (By similarity). |