| O04005 |
| UniProt ID : |
O04005 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
1-Cys peroxiredoxin PER1 |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Nucleus;Cytoplasm; |
| Length : |
216 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0005634 | Cellular Component | nucleus | IEA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | ISS | | GO:0010231 | Biological Process | maintenance of seed dormancy | TAS | | GO:0009269 | Biological Process | response to desiccation | TAS | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | O04005 |
| Sequences : |
MPGITLGDTVPNLEVETTHDKFKLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHKDWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTTGRNMDEVLRALDSLLMASKHNNKIATPVNWKPDQPVVISPAVSDEEAKKMFPQGFKTADLPSKKGYLRHTEVS |
| Function : | Antioxidant protein that seems to contribute to the inhibition of germination during stress. |