| Q9SDD6 |
| UniProt ID : |
Q9SDD6 |
| NCBI Taxonomy : |
39947 |
| Protein names : |
Peroxiredoxin-2F, mitochondrial |
| Organism : |
Oryza sativa subsp. japonica |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Mitochondrion matrix; |
| Length : |
198 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005759 | Cellular Component | mitochondrial matrix | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | | GO:0009060 | Biological Process | aerobic respiration | IEA | | GO:0006096 | Biological Process | glycolysis | IEA | | GO:0046686 | Biological Process | response to cadmium ion | IEA | | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q9SDD6 |
| Sequences : |
MASALLRKATVGGSAAAAAARWASRGLASVGSGSDIVSAAPGVSLQKARSWDEGVATNFSTTPLKDIFHGKKVVIFGLPGAYTGVCSQAHVPSYKNNIDKLKAKGVDSVICVSVNDPYALNGWAEKLQAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGRRSHRWSAFVDDGKIKAFNVEVAPSDFKVSGAEVILDQI |
| Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in mitochondrial redox homeostasis (By similarity). |