Q9SDD6 |
UniProt ID : |
Q9SDD6 |
NCBI Taxonomy : |
39947 |
Protein names : |
Peroxiredoxin-2F, mitochondrial |
Organism : |
Oryza sativa subsp. japonica |
Taxonomy : |
Eukaryota |
Subcellular locations : | Mitochondrion matrix; |
Length : |
198 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005759 | Cellular Component | mitochondrial matrix | IEA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0009060 | Biological Process | aerobic respiration | IEA | GO:0006096 | Biological Process | glycolysis | IEA | GO:0046686 | Biological Process | response to cadmium ion | IEA | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q9SDD6 |
Sequences : |
MASALLRKATVGGSAAAAAARWASRGLASVGSGSDIVSAAPGVSLQKARSWDEGVATNFSTTPLKDIFHGKKVVIFGLPGAYTGVCSQAHVPSYKNNIDKLKAKGVDSVICVSVNDPYALNGWAEKLQAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGRRSHRWSAFVDDGKIKAFNVEVAPSDFKVSGAEVILDQI |
Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in mitochondrial redox homeostasis (By similarity). |