show

Q9RU48

UniProt ID :

NCBI Taxonomy :

Protein names :

Superoxide dismutase [Cu-Zn]

Organism :

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Taxonomy :

Bacteria

Subcellular locations :

Cell membrane;

Length :

182

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0042597	Cellular Component	periplasmic space	IBA
GO:0005886	Cellular Component	plasma membrane	IEA
GO:0005507	Molecullar Function	copper ion binding	IBA
GO:0004784	Molecullar Function	superoxide dismutase activity	IBA
GO:0008270	Molecullar Function	zinc ion binding	IBA
GO:0019430	Biological Process	removal of superoxide radicals	IBA

Catalytic activity :

2 superoxide + 2 H⁺ = O₂ + H₂O₂.

Sequences :

MFRTLTVVPLLALGLSLSACADLGQPTVRADLLDQTGKVTGTATFSPSPIGTRVSIEVSGLKAGPHGLHIHENPNCNPGPDAQGQTIPFGAAGGHFDPGASHNHDGPHARNDQGHGGDLPMITVGEDGKGRLNFDTNRLKMTGPTGVLGRSIVIHADADDYQTNPAGNSGGRERCGVFQAIN

Function :

Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity).