show

Q9QXE4

UniProt ID :

Q9QXE4

NCBI Taxonomy :

10090

Protein names :

Tumor protein p53-inducible nuclear protein 1

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Nucleus;Nucleus;Cytoplasmic vesicle;Cytoplasm;

Length :

239

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005776	Cellular Component	autophagic vacuole	ISS
GO:0031410	Cellular Component	cytoplasmic vesicle	IEA
GO:0005829	Cellular Component	cytosol	ISS
GO:0005634	Cellular Component	nucleus	IDA
GO:0016605	Cellular Component	PML body	IEA
GO:0016209	Molecullar Function	antioxidant activity	IMP
GO:0006915	Biological Process	apoptotic process	IEA
GO:0048102	Biological Process	autophagic cell death	ISS
GO:0006914	Biological Process	autophagy	IEA
GO:0007050	Biological Process	cell cycle arrest	IDA
GO:0071361	Biological Process	cellular response to ethanol	IDA
GO:0071447	Biological Process	cellular response to hydroperoxide	IDA
GO:0072703	Biological Process	cellular response to methyl methanesulfonate	IDA
GO:0034644	Biological Process	cellular response to UV	IDA
GO:0030336	Biological Process	negative regulation of cell migration	IMP
GO:0008285	Biological Process	negative regulation of cell proliferation	IMP
GO:0043065	Biological Process	positive regulation of apoptotic process	IDA
GO:2001235	Biological Process	positive regulation of apoptotic signaling pathway	IGI
GO:0010508	Biological Process	positive regulation of autophagy	ISS
GO:0045893	Biological Process	positive regulation of transcription, DNA-dependent	ISS
GO:0009408	Biological Process	response to heat	IDA
GO:0006351	Biological Process	transcription, DNA-dependent	IEA

Sequences :

MFQRLNKMFVGEVTTSSSQEPEFSEKEDDEWILVDFIDTCPGFSAEEEEEDEDIGEESSAEHTSVFSCLPASLECLTDTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDEYNSSGPRMEAQSEMGKHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQMKHSGWVVHQPCPRQYNY

Function :

Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC.