| Q9NL98 |
| UniProt ID : |
Q9NL98 |
| NCBI Taxonomy : |
6253 |
| Protein names : |
Peroxiredoxin |
| Organism : |
Ascaris suum |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
195 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | NAS | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | | GO:0006979 | Biological Process | response to oxidative stress | IDA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q9NL98 |
| Sequences : |
MSKAMIGKPAPEFTATAVVDGDFKSISLSDYKGKYVVLFFYPMDFTFVCPTEIIAFSEHVGEFKKLGVEVLAASTDSQFSHLAWINTPRKQGGLGEMKIPIISDNNHQISRDYGVLKEDDGIAYRGLFIIDPKGILRQITVNDLPVGRSVTETLRLVQAFQFVDKHGEVCPAGWTPGADTIKPGVKESKAYFEKH |
| Function : | Antioxidant. Reduces peroxides with reducing equivalent provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. |