| Q9N0V4 |
| UniProt ID : |
Q9N0V4 |
| NCBI Taxonomy : |
9913 |
| Protein names : |
Glutathione S-transferase Mu 1 |
| Organism : |
Bos taurus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
218 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0004364 | Molecullar Function | glutathione transferase activity | IEA | |
|
| Catalytic activity : | RX + glutathione = HX + R-S-glutathione. |
| SWISS-MODEL Repository : | Q9N0V4 |
| Sequences : |
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKLTQSNAILRYIARKHNLCGETEEEMIRVDILENQVMDVRLAMARICYSPDFEKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLTYVDFLVYDVLDMHRIFEPKCLDAFPNLKDFISRFEGLKKISAYMKSSRFLPGPLFMKLAVWGNK |
| Function : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Protects against the thiol-mediated metal-catalysed oxidative inactivation of enzymes. |