| Q9LU86 |
| UniProt ID : |
Q9LU86 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
Peroxiredoxin Q, chloroplastic |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid;Plastid; |
| Length : |
216 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009543 | Cellular Component | chloroplast thylakoid lumen | IEA | | GO:0010287 | Cellular Component | plastoglobule | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q9LU86 |
| Sequences : |
MAASSSSFTLCNHTTLRTLPLRKTLVTKTQFSVPTKSSESNFFGSTLTHSSYISPVSSSSLKGLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA |
| Function : | Reduces hydrogen peroxide with reducing equivalents provided through the thioredoxin system. Could be involved in the photosystem II protection against hydrogen peroxide. |