| Q9HEY7 |
| UniProt ID : |
Q9HEY7 |
| NCBI Taxonomy : |
227321 |
| Protein names : |
Superoxide dismutase [Cu-Zn] |
| Organism : |
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
154 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0005576 | Cellular Component | extracellular region | IDA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | ISS | | GO:0010106 | Biological Process | cellular response to iron ion starvation | IEP | | GO:0034599 | Biological Process | cellular response to oxidative stress | IEP | | GO:0006801 | Biological Process | superoxide metabolic process | ISS | |
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | Q9HEY7 |
| Sequences : |
MVKAVAVLRGDSKVSGTVTFEQADENSNTTVSWNITGNDPNAERGFHIHQFGDNTNGCTSAGPHFNPFGKTHGAPEDEVRHVGDLGNFKTDAEGNSKGSKTDKLIKLIGAESVLGRTLVVHAGTDDLGRGDSEESKKTGNAGARPACGVIGIAA |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). |