Q9HEY7 |
UniProt ID : |
Q9HEY7 |
NCBI Taxonomy : |
227321 |
Protein names : |
Superoxide dismutase [Cu-Zn] |
Organism : |
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
154 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0005576 | Cellular Component | extracellular region | IDA | GO:0046872 | Molecullar Function | metal ion binding | IEA | GO:0004784 | Molecullar Function | superoxide dismutase activity | ISS | GO:0010106 | Biological Process | cellular response to iron ion starvation | IEP | GO:0034599 | Biological Process | cellular response to oxidative stress | IEP | GO:0006801 | Biological Process | superoxide metabolic process | ISS | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | Q9HEY7 |
Sequences : |
MVKAVAVLRGDSKVSGTVTFEQADENSNTTVSWNITGNDPNAERGFHIHQFGDNTNGCTSAGPHFNPFGKTHGAPEDEVRHVGDLGNFKTDAEGNSKGSKTDKLIKLIGAESVLGRTLVVHAGTDDLGRGDSEESKKTGNAGARPACGVIGIAA |
Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). |