| Q9GLW7 |
| UniProt ID : |
Q9GLW7 |
| NCBI Taxonomy : |
9534 |
| Protein names : |
Peroxiredoxin-5, mitochondrial |
| Organism : |
Chlorocebus aethiops |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Mitochondrion;Cytoplasm;Peroxisome; |
| Length : |
215 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005739 | Cellular Component | mitochondrion | IEA | | GO:0005777 | Cellular Component | peroxisome | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q9GLW7 |
| Sequences : |
MGLAGVCVLRRSAGYILGGAARQSVAATAAARRRSEGGWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVLACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPSIISQL |
| Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. Involved in intracellular redox signaling (By similarity). |