show

Q9FWR4

UniProt ID :

Q9FWR4

NCBI Taxonomy :

3702

Protein names :

Glutathione S-transferase DHAR1, mitochondrial

Organism :

Arabidopsis thaliana

Taxonomy :

Eukaryota

Subcellular locations :

Mitochondrion;Cytoplasm;Membrane;

Length :

213

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0048046	Cellular Component	apoplast	IDA
GO:0009570	Cellular Component	chloroplast stroma	IDA
GO:0005829	Cellular Component	cytosol	IDA
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0005777	Cellular Component	peroxisome	IDA
GO:0005886	Cellular Component	plasma membrane	IDA
GO:0005773	Cellular Component	vacuole	IDA
GO:0005507	Molecullar Function	copper ion binding	IDA
GO:0045174	Molecullar Function	glutathione dehydrogenase (ascorbate) activity	IDA
GO:0004364	Molecullar Function	glutathione transferase activity	IEA
GO:0005244	Molecullar Function	voltage-gated ion channel activity	IEA
GO:0006952	Biological Process	defense response	IEA
GO:0010731	Biological Process	protein glutathionylation	IDA
GO:0043903	Biological Process	regulation of symbiosis, encompassing mutualism through parasitism	IMP
GO:0009753	Biological Process	response to jasmonic acid stimulus	IEP
GO:0010193	Biological Process	response to ozone	IEP
GO:0009610	Biological Process	response to symbiotic fungus	IEP
GO:0009636	Biological Process	response to toxic substance	IEA
GO:0010043	Biological Process	response to zinc ion	IEP

Catalytic activity :

RX + glutathione = HX + R-S-glutathione.

SWISS-MODEL Repository :

Q9FWR4

Sequences :

MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP

Function :

Displays a dual function. As a soluble protein, exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities. Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses, subsequently to biotic or abiotic inducers. As a peripheral membrane protein, could also function as voltage-gated ion channel.