| Q9FWR4 |
| UniProt ID : |
Q9FWR4 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
Glutathione S-transferase DHAR1, mitochondrial |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Mitochondrion;Cytoplasm;Membrane; |
| Length : |
213 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0048046 | Cellular Component | apoplast | IDA | | GO:0009570 | Cellular Component | chloroplast stroma | IDA | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0005777 | Cellular Component | peroxisome | IDA | | GO:0005886 | Cellular Component | plasma membrane | IDA | | GO:0005773 | Cellular Component | vacuole | IDA | | GO:0005507 | Molecullar Function | copper ion binding | IDA | | GO:0045174 | Molecullar Function | glutathione dehydrogenase (ascorbate) activity | IDA | | GO:0004364 | Molecullar Function | glutathione transferase activity | IEA | | GO:0005244 | Molecullar Function | voltage-gated ion channel activity | IEA | | GO:0006952 | Biological Process | defense response | IEA | | GO:0010731 | Biological Process | protein glutathionylation | IDA | | GO:0043903 | Biological Process | regulation of symbiosis, encompassing mutualism through parasitism | IMP | | GO:0009753 | Biological Process | response to jasmonic acid stimulus | IEP | | GO:0010193 | Biological Process | response to ozone | IEP | | GO:0009610 | Biological Process | response to symbiotic fungus | IEP | | GO:0009636 | Biological Process | response to toxic substance | IEA | | GO:0010043 | Biological Process | response to zinc ion | IEP | |
| Catalytic activity : | RX + glutathione = HX + R-S-glutathione. |
| SWISS-MODEL Repository : | Q9FWR4 |
| Sequences : |
MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP |
| Function : | Displays a dual function. As a soluble protein, exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities. Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses, subsequently to biotic or abiotic inducers. As a peripheral membrane protein, could also function as voltage-gated ion channel. |