Q9FR35
UniProt ID : Q9FR35
NCBI Taxonomy : 39947
Protein names : Peroxiredoxin-2C
Organism : Oryza sativa subsp. japonica
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 162
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0009507Cellular ComponentchloroplastIEA
GO:0005886Cellular Componentplasma membraneIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0046686Biological Processresponse to cadmium ionIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q9FR35
Sequences : MAPVAVGDTLPDGQLGWFDGEDKLQQVSVHGLAAGKKVVLFGVPGAFTPTCSNQHVPGFINQAEQLKAKGVDDILLVSVNDPFVMKAWAKSYPENKHVKFLADGLGTYTKALGLELDLSEKGLGIRSRRFALLADNLKVTVANIEEGGQFTISGAEEILKAL
Function :Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling.