show

Q9DC60

UniProt ID :

Q9DC60

NCBI Taxonomy :

10090

Protein names :

UbiA prenyltransferase domain-containing protein 1

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Endoplasmic reticulum membrane;Golgi apparatus membrane;Mitochondrion;

Length :

336

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005783	Cellular Component	endoplasmic reticulum	ISS
GO:0005789	Cellular Component	endoplasmic reticulum membrane	IEA
GO:0030173	Cellular Component	integral to Golgi membrane	ISS
GO:0005739	Cellular Component	mitochondrion	IEA
GO:0005634	Cellular Component	nucleus	IEA
GO:0016209	Molecullar Function	antioxidant activity	ISS
GO:0004659	Molecullar Function	prenyltransferase activity	ISS
GO:0072358	Biological Process	cardiovascular system development	ISS
GO:0001885	Biological Process	endothelial cell development	ISS
GO:0009234	Biological Process	menaquinone biosynthetic process	ISS
GO:0006744	Biological Process	ubiquinone biosynthetic process	ISS
GO:0042371	Biological Process	vitamin K biosynthetic process	ISS

Sequences :

MAAVQAPGEKINILAGETAKVGDPQKNEWPEQDRLPERSWRHKCASYVLALRPWSFSASLTPVALGSALAYRSQGVLDPRLLLGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSALKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLVILITFGPLAVMFAYAVQVGSLAIFPLIYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYVLYNTLLFVPYLIFTILATHCSISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPRL

Function :

Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10. MK-4 is a vitamin K2 isoform required for endothelial cell development. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosyntetic enzyme: coenzyme Q10, also named ubiquinone, plays a important antioxidant role in the cardiovascular system. Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from NOS3/eNOS-dependent oxidative stress (By similarity).