G3F828 |
UniProt ID : |
G3F828 |
NCBI Taxonomy : |
1077530 |
Protein names : |
Palustrin-2AJ2 |
Organism : |
Amolops jingdongensis |
Taxonomy : |
Eukaryota |
Subcellular locations : | Secreted; |
Length : |
71 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005576 | Cellular Component | extracellular region | IDA | GO:0016209 | Molecullar Function | antioxidant activity | IEA | GO:0019835 | Biological Process | cytolysis | IEA | GO:0050829 | Biological Process | defense response to Gram-negative bacterium | ISS | GO:0050830 | Biological Process | defense response to Gram-positive bacterium | ISS | GO:0044179 | Biological Process | hemolysis in other organism | ISS | |
Sequences : |
MFTLKKPLLVLLFLGTVSLSLCEQERAADDDEGEVIEEEVKRGFMDTAKQVAKNVAVTLIDKLRCKVTGGC |
Function : | Displays broad-spectrum antibacterial activity against a range of Gram-positive and Gram-negative bacteria. Has low hemolytic activity, low cytotoxicity and low antioxidant activity (By similarity). |