Q9C5R8
UniProt ID : Q9C5R8
NCBI Taxonomy : 3702
Protein names : 2-Cys peroxiredoxin BAS1-like, chloroplastic
Organism : Arabidopsis thaliana
Taxonomy : Eukaryota
Subcellular locations :Plastid;
Length : 273
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0048046Cellular ComponentapoplastIDA
GO:0009570Cellular Componentchloroplast stromaIDA
GO:0010319Cellular ComponentstromuleIDA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIDA
GO:0042742Biological Processdefense response to bacteriumIEP
GO:0009409Biological Processresponse to coldIEP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q9C5R8
Sequences : MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLTTNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Function :May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system (By similarity).