Q9C5R8 |
UniProt ID : |
Q9C5R8 |
NCBI Taxonomy : |
3702 |
Protein names : |
2-Cys peroxiredoxin BAS1-like, chloroplastic |
Organism : |
Arabidopsis thaliana |
Taxonomy : |
Eukaryota |
Subcellular locations : | Plastid; |
Length : |
273 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0048046 | Cellular Component | apoplast | IDA | GO:0009570 | Cellular Component | chloroplast stroma | IDA | GO:0010319 | Cellular Component | stromule | IDA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IDA | GO:0042742 | Biological Process | defense response to bacterium | IEP | GO:0009409 | Biological Process | response to cold | IEP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q9C5R8 |
Sequences : |
MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLTTNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
Function : | May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system (By similarity). |