Q9BYN0 |
UniProt ID : |
Q9BYN0 |
NCBI Taxonomy : |
9606 |
Protein names : |
Sulfiredoxin-1 |
Organism : |
Homo sapiens |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
137 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0005524 | Molecullar Function | ATP binding | IEA | GO:0003677 | Molecullar Function | DNA binding | IEA | GO:0016667 | Molecullar Function | oxidoreductase activity, acting on a sulfur group of donors | IDA | GO:0032542 | Molecullar Function | sulfiredoxin activity | IEA | GO:0006979 | Biological Process | response to oxidative stress | IDA | |
Catalytic activity : | Peroxiredoxin-(S-hydroxy-S-oxocysteine) + ATP + 2 R-SH = peroxiredoxin-(S-hydroxycysteine) + ADP + phosphate + R-S-S-R.Magnesium (By similarity). |
SWISS-MODEL Repository : | Q9BYN0 |
Sequences : |
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ |
Function : | Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase. |