| Q9BQE4 |
| UniProt ID : |
Q9BQE4 |
| NCBI Taxonomy : |
9606 |
| Protein names : |
Selenoprotein S |
| Organism : |
Homo sapiens |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Endoplasmic reticulum membrane;Cytoplasm; |
| Length : |
189 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005881 | Cellular Component | cytoplasmic microtubule | IDA | | GO:0030176 | Cellular Component | integral to endoplasmic reticulum membrane | IDA | | GO:0034362 | Cellular Component | low-density lipoprotein particle | IDA | | GO:0005886 | Cellular Component | plasma membrane | TAS | | GO:0034361 | Cellular Component | very-low-density lipoprotein particle | IDA | | GO:0016209 | Molecullar Function | antioxidant activity | IDA | | GO:0004872 | Molecullar Function | receptor activity | NAS | | GO:0008430 | Molecullar Function | selenium binding | IEA | | GO:0045454 | Biological Process | cell redox homeostasis | IDA | | GO:0032869 | Biological Process | cellular response to insulin stimulus | TAS | | GO:0071222 | Biological Process | cellular response to lipopolysaccharide | IMP | | GO:0034599 | Biological Process | cellular response to oxidative stress | IMP | | GO:0030968 | Biological Process | endoplasmic reticulum unfolded protein response | IDA | | GO:0006983 | Biological Process | ER overload response | IDA | | GO:0030433 | Biological Process | ER-associated protein catabolic process | IDA | | GO:0002865 | Biological Process | negative regulation of acute inflammatory response to antigenic stimulus | IMP | | GO:0046325 | Biological Process | negative regulation of glucose import | TAS | | GO:0045719 | Biological Process | negative regulation of glycogen biosynthetic process | TAS | | GO:0032715 | Biological Process | negative regulation of interleukin-6 production | ISS | | GO:1902236 | Biological Process | negative regulation of intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress | IMP | | GO:2000110 | Biological Process | negative regulation of macrophage apoptotic process | IMP | | GO:0051771 | Biological Process | negative regulation of nitric-oxide synthase biosynthetic process | IMP | | GO:0032720 | Biological Process | negative regulation of tumor necrosis factor production | ISS | | GO:0006111 | Biological Process | regulation of gluconeogenesis | TAS | | GO:0080164 | Biological Process | regulation of nitric oxide metabolic process | IMP | | GO:0009749 | Biological Process | response to glucose stimulus | IEP | | GO:0051775 | Biological Process | response to redox state | IDA | | GO:0030970 | Biological Process | retrograde protein transport, ER to cytosol | IDA | |
| SWISS-MODEL Repository : | Q9BQE4 |
| Sequences : |
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG |
| Function : | Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination. |