Q9BGI3
UniProt ID : Q9BGI3
NCBI Taxonomy : 9913
Protein names : Peroxiredoxin-2
Organism : Bos taurus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 199
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0042981Biological Processregulation of apoptotic processIEA
GO:0019430Biological Processremoval of superoxide radicalsIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q9BGI3
Sequences : MACVCKAHVGKPAPEFQATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRKLSSDYGVLKEDEGIAYRGLFVIDGKGVLRQVTINDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWTPGSDTIKPNVDDSKEYFSKHN
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).