Q9BGI2 |
UniProt ID : |
Q9BGI2 |
NCBI Taxonomy : |
9913 |
Protein names : |
Peroxiredoxin-4 |
Organism : |
Bos taurus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm;Secreted; |
Length : |
274 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005576 | Cellular Component | extracellular region | IEA | GO:0005739 | Cellular Component | mitochondrion | IEA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0072593 | Biological Process | reactive oxygen species metabolic process | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q9BGI2 |
Sequences : |
MEAPPPPPPLPATTLAPGRSRKLLLLPLLLFLLRAEAVRGFEAEERPRTREEECHFYAGGQVYPGEVSRVSVAEHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIDEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGSINIPLLADLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN |
Function : | Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation (By similarity). |