G3ETQ3
UniProt ID : G3ETQ3
NCBI Taxonomy : 1077530
Protein names : Palustrin-2AJ1
Organism : Amolops jingdongensis
Taxonomy : Eukaryota
Subcellular locations :Secreted;
Length : 71
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005576Cellular Componentextracellular regionIDA
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0019835Biological ProcesscytolysisIEA
GO:0050829Biological Processdefense response to Gram-negative bacteriumIDA
GO:0050830Biological Processdefense response to Gram-positive bacteriumIDA
GO:0044179Biological Processhemolysis in other organismIDA
Sequences : MFTLKKPLLVLLFLGTVSLSLCEQERAADDDEGEVIEEEVKRGFMDTAKNVAKNVAVTLIDKLRCKVTGGC
Function :Displays broad-spectrum antibacterial activity against a range of Gram-positive and Gram-negative bacteria. Has low hemolytic activity, low cytotoxicity and low antioxidant activity.