| Q9AGW2 |
| UniProt ID : |
Q9AGW2 |
| NCBI Taxonomy : |
262316 |
| Protein names : |
Superoxide dismutase [Cu-Zn] |
| Organism : |
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Cell membrane; |
| Length : |
227 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005886 | Cellular Component | plasma membrane | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
|
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | Q9AGW2 |
| Sequences : |
MPKLLPPVVLAGCVVALGACSSPQHASSLPGTTPAVWTGSPSPSGAGAAEAAPAAAPSITTHLKAPDGTQVATAKFEFSNGYATVTIETTANGVLTPGFHGVHIHKVGKCEPSSVAPTGGAPGDFLSAGGHFQAPGHTGEPASGDLTSLQVRKDGSGTLVTTTDAFTMEDLLGGRKTAIIIHAGADNFANIPAERYNQTNGTPGPDEMTMSTGDAGKRVACGVIGAG |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. May play a role in favoring mycobacterial survival in phagocytes (By similarity). |