| Q99MS3 |
| UniProt ID : |
Q99MS3 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Mpv17-like protein |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Peroxisome membrane;Cytoplasm; |
| Length : |
194 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016021 | Cellular Component | integral to membrane | IEA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0005778 | Cellular Component | peroxisomal membrane | IEA | | GO:0005777 | Cellular Component | peroxisome | ISS | | GO:0072593 | Biological Process | reactive oxygen species metabolic process | ISS | |
|
| Sequences : |
MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFIFLRRKEASDKSPEK |
| Function : | Isoform 1 and isoform 3 participate in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes. |