show

Q99J99

UniProt ID :

Q99J99

NCBI Taxonomy :

10090

Protein names :

3-mercaptopyruvate sulfurtransferase

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Mitochondrion;Cell junction;

Length :

297

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0030054	Cellular Component	cell junction	IEA
GO:0005743	Cellular Component	mitochondrial inner membrane	IDA
GO:0043005	Cellular Component	neuron projection	IDA
GO:0045202	Cellular Component	synapse	IEA
GO:0016784	Molecullar Function	3-mercaptopyruvate sulfurtransferase activity	IEA
GO:0004792	Molecullar Function	thiosulfate sulfurtransferase activity	IEA
GO:0070814	Biological Process	hydrogen sulfide biosynthetic process	IDA

Catalytic activity :

3-mercaptopyruvate + cyanide = pyruvate + thiocyanate.

SWISS-MODEL Repository :

Q99J99

Sequences :

MAAPQLFRALVSAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPNATHFADYAGSLGVSAATHVVIYDGSDQGPYSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGRGKTQ

Function :

Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), contributes to the catabolism of cysteine and is an important producer of hydrogen sulfide in the brain, retina and vascular endothelial cells. Hydrogen sulfide H(2)S is an important synaptic modulator, signaling molecule, smooth muscle contractor and neuroprotectant. Its production by the 3MST/CAT pathway is regulated by calcium ions.