| Q98SV1 |
| UniProt ID : |
Q98SV1 |
| NCBI Taxonomy : |
7955 |
| Protein names : |
Selenoprotein Pa |
| Organism : |
Danio rerio |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
367 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005576 | Cellular Component | extracellular region | IDA | | GO:0008430 | Molecullar Function | selenium binding | IEA | | GO:0006979 | Biological Process | response to oxidative stress | NAS | |
|
| Sequences : |
MWKALSLTLALCLLVGCSAESETEGARCKLPPEWKVGDVEPMKNALGQVTVVAYLQASULFCLEQASKLNDLLLKLENQGYPNIAYMVVNNREERSQRLHHLLQERLLNITLYAQDLSQPDAWQAVNAEKDDILVYDRCGRLTYHLSLPYTILSHPHVEEAIKHTYCDRICGECSLESSAQLEECKKATEEVNKPVEEEPRQDHGHHEHGHHEHQGEAERHRHGHHHPHHHHHHHRGQQQVDVDQQVLSQVDFGQVAVETPMMKRPUAKHSRUKVQYSUQQGADSPVASUCUHURQLFGGEGNGRVAGLUHCDEPLPASUPUQGLKEQDNHIKETUQURPAPPAEUELSQPTUVUPAGDATUGURKK |
| Function : | Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium (By similarity). |