| Q98SV0 |
| UniProt ID : |
Q98SV0 |
| NCBI Taxonomy : |
7955 |
| Protein names : |
Selenoprotein Pb |
| Organism : |
Danio rerio |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
265 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005576 | Cellular Component | extracellular region | NAS | | GO:0008430 | Molecullar Function | selenium binding | IEA | | GO:0006979 | Biological Process | response to oxidative stress | NAS | |
|
| Sequences : |
MQALWPLLLSALPALLGASSLFVEKESNGSRICKPAPQWEIDGKTPMKELLGNVVVVALLKASUHFCLTQAARLGDLRDKLANGGLTNISFMVVNEQDSQSRAMYWELKRRTAQDIPVYQQSPLQNDVWEILEGDKDDFLVYDRCGYLTFHIVLPFSFLHYPYIEAAIRATYHKNMCNCSLNANFSISESSDSTKNDPAGENNQRPNSTEPVTAAHHHHHQQHEPHHHHHNPYPNSHKKSGDSDVTGKPKEPPHHSHQEHVHNHR |
| Function : | Might be responsible for some of the extracellular antioxidant defense properties of selenium. |