| G3ETQ2 |
| UniProt ID : |
G3ETQ2 |
| NCBI Taxonomy : |
1077530 |
| Protein names : |
Jindongenin-1a |
| Organism : |
Amolops jingdongensis |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
66 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005576 | Cellular Component | extracellular region | IDA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0019835 | Biological Process | cytolysis | IEA | | GO:0050832 | Biological Process | defense response to fungus | IDA | | GO:0050829 | Biological Process | defense response to Gram-negative bacterium | IDA | | GO:0050830 | Biological Process | defense response to Gram-positive bacterium | IDA | | GO:0044179 | Biological Process | hemolysis in other organism | IDA | |
| Sequences : |
MFTLKKPLLLLFFLGTVSLSLCEQERAADDDEGEVIEEEVKRDSMGAVKLAKLLIDKMKCEVTKAC |
| Function : | Displays broad-spectrum antibacterial activity against a range of Gram-positive and Gram-negative bacteria. Also displays antifungal activity against C.albicans ATCC 2002. Has low hemolytic activity, low cytotoxicity and low antioxidant activity. |