show

Q96A56

UniProt ID :

Q96A56

NCBI Taxonomy :

9606

Protein names :

Tumor protein p53-inducible nuclear protein 1

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Nucleus;Nucleus;Cytoplasmic vesicle;

Length :

240

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005776	Cellular Component	autophagic vacuole	IDA
GO:0031410	Cellular Component	cytoplasmic vesicle	IEA
GO:0005829	Cellular Component	cytosol	IDA
GO:0005634	Cellular Component	nucleus	IDA
GO:0016605	Cellular Component	PML body	IEA
GO:0016209	Molecullar Function	antioxidant activity	ISS
GO:0006915	Biological Process	apoptotic process	IEA
GO:0048102	Biological Process	autophagic cell death	IMP
GO:0006914	Biological Process	autophagy	IEA
GO:0007050	Biological Process	cell cycle arrest	TAS
GO:0030336	Biological Process	negative regulation of cell migration	ISS
GO:0008285	Biological Process	negative regulation of cell proliferation	ISS
GO:0010508	Biological Process	positive regulation of autophagy	IMP
GO:0045893	Biological Process	positive regulation of transcription, DNA-dependent	IDA
GO:0006950	Biological Process	response to stress	TAS
GO:0006351	Biological Process	transcription, DNA-dependent	IEA

Sequences :

MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY

Function :

Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC.