| Q96A56 |
| UniProt ID : |
Q96A56 |
| NCBI Taxonomy : |
9606 |
| Protein names : |
Tumor protein p53-inducible nuclear protein 1 |
| Organism : |
Homo sapiens |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Nucleus;Nucleus;Cytoplasmic vesicle; |
| Length : |
240 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005776 | Cellular Component | autophagic vacuole | IDA | | GO:0031410 | Cellular Component | cytoplasmic vesicle | IEA | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0016605 | Cellular Component | PML body | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | ISS | | GO:0006915 | Biological Process | apoptotic process | IEA | | GO:0048102 | Biological Process | autophagic cell death | IMP | | GO:0006914 | Biological Process | autophagy | IEA | | GO:0007050 | Biological Process | cell cycle arrest | TAS | | GO:0030336 | Biological Process | negative regulation of cell migration | ISS | | GO:0008285 | Biological Process | negative regulation of cell proliferation | ISS | | GO:0010508 | Biological Process | positive regulation of autophagy | IMP | | GO:0045893 | Biological Process | positive regulation of transcription, DNA-dependent | IDA | | GO:0006950 | Biological Process | response to stress | TAS | | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
| Sequences : |
MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY |
| Function : | Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC. |