| Q96291 |
| UniProt ID : |
Q96291 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
2-Cys peroxiredoxin BAS1, chloroplastic |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid; |
| Length : |
266 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0048046 | Cellular Component | apoplast | IDA | | GO:0009941 | Cellular Component | chloroplast envelope | IDA | | GO:0009570 | Cellular Component | chloroplast stroma | IDA | | GO:0010319 | Cellular Component | stromule | IDA | | GO:0009579 | Cellular Component | thylakoid | IDA | | GO:0004601 | Molecullar Function | peroxidase activity | IDA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IDA | | GO:0042742 | Biological Process | defense response to bacterium | IEP | | GO:0009409 | Biological Process | response to cold | IEP | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q96291 |
| Sequences : |
MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSRRSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
| Function : | May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. |