| Q94BT9 |
| UniProt ID : |
Q94BT9 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
Copper transport protein ATX1 |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
106 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0000785 | Cellular Component | chromatin | IDA | | GO:0005829 | Cellular Component | cytosol | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0006825 | Biological Process | copper ion transport | IEA | |
|
| Catalytic activity : | Binds 1 copper ion per subunit (By similarity). |
| SWISS-MODEL Repository : | Q94BT9 |
| Sequences : |
MLKDLFQAVSYQNTASLSLFQALSVVESKAMSQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWEAEGETAKA |
| Function : | Plays an important role in copper homeostasis by conferring tolerance to excess of copper and subclinical copper deficiency during vegetative stage. Can complement the yeast mutants atx1 and sod1. |