Q949U7 |
UniProt ID : |
Q949U7 |
NCBI Taxonomy : |
3702 |
Protein names : |
Peroxiredoxin-2E, chloroplastic |
Organism : |
Arabidopsis thaliana |
Taxonomy : |
Eukaryota |
Subcellular locations : | Plastid; |
Length : |
234 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009941 | Cellular Component | chloroplast envelope | IDA | GO:0009570 | Cellular Component | chloroplast stroma | IDA | GO:0009505 | Cellular Component | plant-type cell wall | IDA | GO:0009579 | Cellular Component | thylakoid | IDA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0042742 | Biological Process | defense response to bacterium | IEP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q949U7 |
Sequences : |
MATSLSVSRFMSSSATVISVAKPLLSPTVSFTAPLSFTRSLAPNLSLKFRNRRTNSASATTRSFATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQKHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLGVELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAEDMLKAL |
Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in chloroplast redox homeostasis. |