Q949U7
UniProt ID : Q949U7
NCBI Taxonomy : 3702
Protein names : Peroxiredoxin-2E, chloroplastic
Organism : Arabidopsis thaliana
Taxonomy : Eukaryota
Subcellular locations :Plastid;
Length : 234
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0009941Cellular Componentchloroplast envelopeIDA
GO:0009570Cellular Componentchloroplast stromaIDA
GO:0009505Cellular Componentplant-type cell wallIDA
GO:0009579Cellular ComponentthylakoidIDA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0042742Biological Processdefense response to bacteriumIEP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q949U7
Sequences : MATSLSVSRFMSSSATVISVAKPLLSPTVSFTAPLSFTRSLAPNLSLKFRNRRTNSASATTRSFATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQKHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLGVELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAEDMLKAL
Function :Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in chloroplast redox homeostasis.