show

Q923X4

UniProt ID :

Q923X4

NCBI Taxonomy :

10090

Protein names :

Glutaredoxin-2, mitochondrial

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Mitochondrion;Nucleus;

Length :

156

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005739	Cellular Component	mitochondrion	ISS
GO:0005634	Cellular Component	nucleus	ISS
GO:0051537	Molecullar Function	2 iron, 2 sulfur cluster binding	IEA
GO:0009055	Molecullar Function	electron carrier activity	IEA
GO:0046872	Molecullar Function	metal ion binding	IEA
GO:0015035	Molecullar Function	protein disulfide oxidoreductase activity	IEA
GO:0045454	Biological Process	cell redox homeostasis	IEA
GO:0042542	Biological Process	response to hydrogen peroxide	ISS
GO:0010033	Biological Process	response to organic substance	ISS

SWISS-MODEL Repository :

Q923X4

Sequences :

MSWRRAASVGRRLVASGRILAGRRGAAGAAGSGMGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

Function :

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.