show

E7FB98

UniProt ID :

E7FB98

NCBI Taxonomy :

7955

Protein names :

UbiA prenyltransferase domain-containing protein 1

Organism :

Danio rerio

Taxonomy :

Eukaryota

Subcellular locations :

Endoplasmic reticulum membrane;Golgi apparatus membrane;Mitochondrion;

Length :

336

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005789	Cellular Component	endoplasmic reticulum membrane	IEA
GO:0030173	Cellular Component	integral to Golgi membrane	IDA
GO:0005739	Cellular Component	mitochondrion	IEA
GO:0016209	Molecullar Function	antioxidant activity	IMP
GO:0004517	Molecullar Function	nitric-oxide synthase activity	IGI
GO:0004659	Molecullar Function	prenyltransferase activity	IDA
GO:0072358	Biological Process	cardiovascular system development	IMP
GO:0071498	Biological Process	cellular response to fluid shear stress	IGI
GO:0001885	Biological Process	endothelial cell development	IMP
GO:0009234	Biological Process	menaquinone biosynthetic process	IMP
GO:0006744	Biological Process	ubiquinone biosynthetic process	IMP
GO:0042371	Biological Process	vitamin K biosynthetic process	IMP

Sequences :

MQEMKPAALSGSNGLNGASGSSVRVPCSRLSRAGRMALDLQSKCAAYVLALRPWSFSASLTPVALGSALAYKLEGSVDLLLLLVCAVAVLLVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDQILKPQDVVMFGAVLYSAGCLCATLLYFLSSLKLEHLALIYFGGLSSSFLYTGGIGLKYVALGDVVILITFGPLAVMFAHAVQVGYLSVLPLVYAVPLALNTEAILHSNNTRDMDSDKQAGIVTLAILLGPTLSYVIYNLLLFVPYLLFCILATRYTISMALPLLTLPMAFPLERQFRCRCYAKIPQKTAKLNLLMGLFYVFGIILAPQGSLPLL

Function :

Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10. MK-4 is a vitamin K2 isoform required for endothelial cell development. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosyntetic enzyme: coenzyme Q10, also named ubiquinone, plays a important antioxidant role in the cardiovascular system. Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from nos3/eNOS-dependent oxidative stress.