| Q8ZPS6 |
| UniProt ID : |
Q8ZPS6 |
| NCBI Taxonomy : |
99287 |
| Protein names : |
Anti-FlhC(2)FlhD(4) factor YdiV |
| Organism : |
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Taxonomy : |
Bacteria |
| Length : |
237 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009405 | Biological Process | pathogenesis | IEA | | GO:0006355 | Biological Process | regulation of transcription, DNA-dependent | IEA | | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
|
| Sequences : |
MIASLDELYHSELFFLPVMDENARLVGLEIIATFAAEDGAVRMPTELVAPRLSVEEQYCLFVEKLALLETCQHFFIQHKLIAWLNLPPAISDLLLLDSELFSRAARFPFLELAINENYPGLNQGKNNETLANLAMHFPLMLANFGAGEASTKAIFDGLFKRVMLDKNFIQQRAEMISFEPFMHAIVAQISSSCESLMIAGIDTEAMFARAAPLGFSAFQGGLWPPVPVSQLIKLVQR |
| Function : | Acts as an anti-FlhC(2)FlhD(4) factor by binding to FlhD, decreasing its ability to bind DNA, and thus negatively regulates expression of flagellar class II operons, decreasing motility in nutrient-poor medium. Required for resistance to host phagocyte oxidase. Suppresses killing of macrophages, while promoting resistance to hydrogen peroxide. Data regarding c-di-GMP is controversial; suppresses bacterial c-di-GMP levels (PubMed:15882417) but neither synthesizes nor degrades c-di-GMP (PubMed:19376870). |