Q8VWJ1 |
UniProt ID : |
Q8VWJ1 |
NCBI Taxonomy : |
3702 |
Protein names : |
Homogentisate phytyltransferase 1, chloroplastic |
Organism : |
Arabidopsis thaliana |
Taxonomy : |
Eukaryota |
Subcellular locations : | Plastid; |
Length : |
393 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009507 | Cellular Component | chloroplast | ISS | GO:0009535 | Cellular Component | chloroplast thylakoid membrane | IEA | GO:0016021 | Cellular Component | integral to membrane | IEA | GO:0010176 | Molecullar Function | homogentisate phytyltransferase activity | IDA | GO:0071555 | Biological Process | cell wall organization | IMP | GO:0009915 | Biological Process | phloem sucrose loading | IMP | GO:0031347 | Biological Process | regulation of defense response | IMP | GO:0009266 | Biological Process | response to temperature stimulus | IMP | GO:0006636 | Biological Process | unsaturated fatty acid biosynthetic process | IMP | GO:0010189 | Biological Process | vitamin E biosynthetic process | IMP | |
Catalytic activity : | All-trans-phytyl diphosphate + homogentisate = diphosphate + 2-methyl-6-phytyl-1,4-benzoquinol + CO2. |
Sequences : |
MESLLSSSSLVSAAGGFCWKKQNLKLHSLSEIRVLRCDSSKVVAKPKFRNNLVRPDGQGSSLLLYPKHKSRFRVNATAGQPEAFDSNSKQKSFRDSLDAFYRFSRPHTVIGTVLSILSVSFLAVEKVSDISPLLFTGILEAVVAALMMNIYIVGLNQLSDVEIDKVNKPYLPLASGEYSVNTGIAIVASFSIMSFWLGWIVGSWPLFWALFVSFMLGTAYSINLPLLRWKRFALVAAMCILAVRAIIVQIAFYLHIQTHVFGRPILFTRPLIFATAFMSFFSVVIALFKDIPDIEGDKIFGIRSFSVTLGQKRVFWTCVTLLQMAYAVAILVGATSPFIWSKVISVVGHVILATTLWARAKSVDLSSKTEITSCYMFIWKLFYAEYLLLPFLK |
Function : | Involved in the synthesis of tocopherol (vitamin E). Catalyzes the condensation of homogentisate and phytyl diphosphate to form dimethylphytylhydrquinone. Tocopherol functions to limit lipid oxidation during seed desiccation, quiescence and germination and early seedling development. Protects thylakoid membrane lipids from photooxidation and is required for low-temperature adaptation. |