show

Q8VWJ1

UniProt ID :

Q8VWJ1

NCBI Taxonomy :

3702

Protein names :

Homogentisate phytyltransferase 1, chloroplastic

Organism :

Arabidopsis thaliana

Taxonomy :

Eukaryota

Subcellular locations :

Plastid;

Length :

393

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0009507	Cellular Component	chloroplast	ISS
GO:0009535	Cellular Component	chloroplast thylakoid membrane	IEA
GO:0016021	Cellular Component	integral to membrane	IEA
GO:0010176	Molecullar Function	homogentisate phytyltransferase activity	IDA
GO:0071555	Biological Process	cell wall organization	IMP
GO:0009915	Biological Process	phloem sucrose loading	IMP
GO:0031347	Biological Process	regulation of defense response	IMP
GO:0009266	Biological Process	response to temperature stimulus	IMP
GO:0006636	Biological Process	unsaturated fatty acid biosynthetic process	IMP
GO:0010189	Biological Process	vitamin E biosynthetic process	IMP

Catalytic activity :

All-trans-phytyl diphosphate + homogentisate = diphosphate + 2-methyl-6-phytyl-1,4-benzoquinol + CO₂.

Sequences :

MESLLSSSSLVSAAGGFCWKKQNLKLHSLSEIRVLRCDSSKVVAKPKFRNNLVRPDGQGSSLLLYPKHKSRFRVNATAGQPEAFDSNSKQKSFRDSLDAFYRFSRPHTVIGTVLSILSVSFLAVEKVSDISPLLFTGILEAVVAALMMNIYIVGLNQLSDVEIDKVNKPYLPLASGEYSVNTGIAIVASFSIMSFWLGWIVGSWPLFWALFVSFMLGTAYSINLPLLRWKRFALVAAMCILAVRAIIVQIAFYLHIQTHVFGRPILFTRPLIFATAFMSFFSVVIALFKDIPDIEGDKIFGIRSFSVTLGQKRVFWTCVTLLQMAYAVAILVGATSPFIWSKVISVVGHVILATTLWARAKSVDLSSKTEITSCYMFIWKLFYAEYLLLPFLK

Function :

Involved in the synthesis of tocopherol (vitamin E). Catalyzes the condensation of homogentisate and phytyl diphosphate to form dimethylphytylhydrquinone. Tocopherol functions to limit lipid oxidation during seed desiccation, quiescence and germination and early seedling development. Protects thylakoid membrane lipids from photooxidation and is required for low-temperature adaptation.