| Q8T6C4 |
| UniProt ID : |
Q8T6C4 |
| NCBI Taxonomy : |
6210 |
| Protein names : |
Thioredoxin peroxidase |
| Organism : |
Echinococcus granulosus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
193 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q8T6C4 |
| Sequences : |
MAAVVGKLAPSFTCKALVDGELKDVSLSDYRGKYVILFFYPMDFTFVCPTEIIAFNDRADEFHQRGCQLLACSTDSGYCHLAWNNVSRKEGGVQGMRIPMLADTNHKISRDYGVLIEDQGIALRGLFIIDDKGVLRQITINDLPVGRSVDEALRLLDAFQFTDKHGEVCPANWQPGSKTFKPSAGDLKSFMSS |
| Function : | Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). |