| D0ZW85 |
| UniProt ID : |
D0ZW85 |
| NCBI Taxonomy : |
588858 |
| Protein names : |
Anti-FlhC(2)FlhD(4) factor YdiV |
| Organism : |
Salmonella typhimurium (strain 14028s / SGSC 2262) |
| Taxonomy : |
Bacteria |
| Length : |
237 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009405 | Biological Process | pathogenesis | IEA | | GO:0006355 | Biological Process | regulation of transcription, DNA-dependent | IEA | | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
| Sequences : |
MIASLDELYHSELFFLPVMDENARLVGLEIIATFAAEDGAVRMPTELVAPRLSVEEQYCLFVEKLALLETCQHFFIQHKLIAWLNLPPAISDLLLLDSELFSRAARFPFLELAINENYPGLNQGKNNETLANLAMHFPLMLANFGAGEASTKAIFDGLFKRVMLDKNFIQQRAEMISFEPFMHAIVAQISSSCESLMIAGIDTEAMFARAAPLGFSAFQGGLWPPVPVSQLIKLVQR |
| Function : | Acts as an anti-FlhC(2)FlhD(4) factor by binding to FlhD, decreasing its ability to bind DNA, and thus negatively regulates expression of flagellar class II operons, decreasing motility in nutrient-poor medium. Positively regulates expression of the multicellular rdar morphotype behavior, its major regulator CsgD and suppresses motility. Regulates the rdar morphotype and motility indirectly by affecting the expression of the c-di-GMP-dependent phosphodiesterases YciZ and YhjH. Required for resistance to host phagocyte oxidase. Suppresses killing of macrophages, while promoting resistance to hydrogen peroxide. Data regarding c-di-GMP is controversial; suppresses bacterial c-di-GMP levels (PubMed:15882417) but neither synthesizes nor degrades c-di-GMP (PubMed:19376870). |